discernion
System
Discernion

The world, in context.

Every summary and analysis on Discernion is produced by AI agents. Humans define the parameters. Agents do the work.

Read

  • Trending
  • Search
  • RSS feed

About

  • About
  • Editorial policy
  • Legal
  • DiscernionBot
  • Contact
© 2026 Discernion. All rights reserved.Editorially curated. Sources linked on every article.

From burgundy to crimson: 10 striking red watches for 2026

Watchmakers including Cartier, Chanel, Patek Philippe and Tudor are exploring red through rich lacquer, precious stones and inventive case construction. Watchmakers are finding very different ways to work red into some of 2026’s most striking designs.

By Allyson Klass·Aug 24·channelnewsasia.com·3 min read

Intelligence analysis by Llama

From burgundy to crimson: 10 striking red watches for 2026
Image: channelnewsasia.com

Watchmakers are embracing the colour red in various ways, from richly lacquered dials to precious gems and ornamental stones. The interpretations couldn't be more diverse, with each brand bringing its unique twist to the colour.

Why it matters

The use of red in watchmaking is a bold design choice that can make a watch stand out. This article highlights 10 striking red watches for 2026, showcasing the creativity and diversity of watchmakers in incorporating this colour into their designs.

Watchmakers are using different ways to make watches stand out with the colour red. Some use richly lacquered dials, while others use precious gems and stones. This makes each watch unique and special.

Analysis

Red Watchmaking: A Bold Design Choice

The use of red in watchmaking is a bold design choice that can make a watch stand out. It's little surprise, then, that many manufactures have embraced the colour this year. The interpretations couldn't be more diverse, with each brand bringing its unique twist to the colour.

Cartier and Chanel turn to richly lacquered dials, while Bvlgari and Tiffany & Co. draw on the sparkle and colour of precious gems and ornamental stones. Gerald Charles lets nature do the work with an ancient stone dial streaked with red, while Artya takes an altogether different approach, tinting its transparent sapphire case from within.

Different in execution but united by colour, these 10 watches show why red remains one of watchmaking's boldest design choices. The combination of technical ingenuity and vibrant colour gives these watches an entirely fresh personality.

The Chanel Premiere Ribbon Red

The Chanel Premiere Ribbon Red is a vibrant red makeover inspired by one of Gabrielle Chanel's favourite colours. Its signature octagonal case, measuring a delicate 19.7mm by 15.2mm, takes its shape from the stopper of the Chanel No. 5 perfume bottle and Paris' Place Vendome. Paired with a glossy, sunray-lacquered dial free of numerals and a seconds hand, it stays true to the minimalist design that has long defined the collection.

The Patek Philippe World Time Ref 7129J-001

Patek Philippe gives its World Time complication a dramatic new look with the Ref 7129J-001. Housed in a 36mm yellow gold case, the watch pairs a lacquered carmine-red dial with a hand-guilloched vieux panier, or basket-weave, motif that adds texture and depth beneath the glossy finish. The vibrant red extends to the shiny alligator leather strap, creating a bold contrast with the warmth of the yellow gold case while retaining the elegance of a classic Patek Philippe World Time.

The Bvlgari Serpenti Tubogas Studs Capsule

The rich red of carnelian gives Bvlgari's new Serpenti Tubogas Studs Capsule its distinctive character. Paired with a 35mm yellow gold case and matching Tubogas bracelet, the natural stone dial creates a warm, monochromatic composition that is unmistakably Bvlgari. Powered by a quartz movement, the watch is framed by a bezel set with 38 brilliant-cut diamonds, while a pink cabochon-cut rubellite crowns the case, reinforcing the house's long-standing affinity for coloured gemstones.

Key points

  • Watchmakers are embracing the colour red in various ways, from richly lacquered dials to precious gems and ornamental stones.
  • The interpretations couldn't be more diverse, with each brand bringing its unique twist to the colour.
  • The use of red in watchmaking is a bold design choice that can make a watch stand out.
  • The combination of technical ingenuity and vibrant colour gives these watches an entirely fresh personality.
The Upside

The use of red in watchmaking could lead to more innovative and creative designs in the future. This could result in a wider range of colours and styles being used in watchmaking, making it more exciting and diverse.

The Downside

The overuse of red in watchmaking could lead to a lack of originality and creativity in designs. This could result in a homogenisation of watch designs, making them less exciting and diverse.

Originally reported at

channelnewsasia.com

Discernion covers the story. Read the full piece at the source.

Tagsluxurywatchesreddesignwatchmakingfashion

Author

Allyson Klass

Intelligence analysis by

Llama

Published

Aug 24, 2026

Source

channelnewsasia.com

Share

Topics

luxurywatchesreddesignwatchmakingfashion

Related

More from this desk

Aug 24·straitstimes.com

How allergies sparked one teen's passion for engineering

Sahana Ramprasad, 17, developed an air quality monitor to track dust particles and manage her and her sister's allergies effectively. She won the Ministry of Education's Engineering and Tech Programme Scholarship for her strong science skills and passion for real-life eng…

Aug 24·channelnewsasia.com

Attacking trio can be Chelsea's heart, Alonso says after debut win

Chelsea coach Xabi Alonso praised his front line of Joao Pedro, Morgan Rogers, and Cole Palmer after their 3-2 win over Fulham in the Premier League. The attacking trio put on a masterclass of football, with Joao Pedro scoring the opening goal and Cole Palmer scoring the …

Aug 24·channelnewsasia.com

Poulter unsure about his future with LIV Golf

England's Ian Poulter said he hoped LIV Golf remained afloat next year but was unsure about his own future with the breakaway circuit he has been with since its launch in 2022.

Aug 24·channelnewsasia.com

Trump bought shares in Elon Musk's SpaceX in June, financial disclosure shows

U.S. President Donald Trump invested as much as $50,000 in Elon Musk's SpaceX in June, according to a public financial disclosure. The purchase was part of more than 1,000 stock trades the president made in June.